Results of the de novo motif search

This sample output page is generated for the ZIP file (corresponding to the TRG_LysEnd_APsAcLL_3 protein set as of 26.03.2016 with putative orthologs) as well as the sample query regions file submitted in advanced mode. The sought-for motifs are highlighted in background blue according to the ELM annotation. This highlighting will not show up in real outputs.

Read the guide  |  Launch a new motif search

Number of found motif trees: 3

Found motif trees:
(click to see more information)
Prot.       Motif root
0000   511 QEERQPLL 518
0001   471 ERAPLI 476
0002   547 ERNPLL 552

0000 (P11344_orthologs.fasta):
MFLAVLYCLLWSFQISDGHFPRACASSKNLLAKECCPPWMGDGSPCGQLSGRGSCQDILLSSAPSGPQFPFKGVDDRESW 80
PSVFYNRTCQCSGNFMGFNCGNCKFGFGGPNCTEKRVLIRRNIFDLSVSEKNKFFSYLTLAKHTISSVYVIPTGTYGQMN 160
NGSTPMFNDINIYDLFVWMHYYVSRDTLLGGSEIWRDIDFAHEAPGFLPWHRLFLLLWEQEIRELTGDENFTVPYWDWRD 240
AENCDICTDEYLGGRHPENPNLLSPASFFSSWQIICSRSEEYNSHQVLCDGTPEGPLLRNPGNHDKAKTPRLPSSADVEF 320
CLSLTQYESGSMDRTANFSFRNTLEGFASPLTGIADPSQSSMHNALHIFMNGTMSQVQGSANDPIFLLHHAFVDSIFEQW 400
LRRHRPLLEVYPEANAPIGHNRDSYMVPFIPLYRNGDFFITSKDLGYDYSYLQESDPGFYRNYIEPYLEQASRIWPWLLG 480
AALVGAVIAAALSGLSSRLCLQKKKKKKQPQEERQPLLMDKDDYHSLLYQSHL 533

0001 (Q14108_orthologs.fasta):
MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGET 80
PRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAML 160
KAYQQKLFVTHTVDELLWGYKDEILSLIHVFRPDISPYFGLFYEKNGTNDGDYVFLTGEDSYLNFTKIVEWNGKTSLDWW 240
ITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLG 320
SGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGD 400
IRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITNIPYIIMALGVFFGLVFTWLACKGQGSMDEGTADERAPLIRT 478

0002 (Q90372_orthologs.fasta):
MSQAHRHLALLLPAEAVLCAAAMRFQDVLSNGRTAPVTNHKKIQGWSSDQNKWNEKLYPFWEDNDPRWKDCWKGGKVTTK 80
LVTDSPALVGSNVTFVVTLQFPKCQKEDDDGNIIYQRNCTPDSPAAQDQYVYNWTEWIDNCGWENCTSNHSHNVFPDGKP 160
FPHYPGWRRRNFVYLFHTVGQYYQTIGRSSANFSVNTANITLGKHIMAVSIYRRGHSTYVPIARASTTYVVTDKIPILVS 240
MSQKHDRNISDSIFIKDSPITFDVKIHDPSYYLNDSAISYKWNFGDGSGLFVESGATTSHTFSLQGNFTLNLTVQAIIPV 320
PCKPVTPTPSLPTPAVTTDASSNSDPSAPNEMAEDNPDGGCHIYRYGYYTAGITIVEGILEVNIIQMTSIQMTESQAENP 400
LVDFVVTCQGSFPTDVCTAVSDPTCQVSQGMVCDPVVVTDECVLTIRRAFDEPGTYCINITLGDDTSQALASALISVNGG 480
SSSGTTKGVFIFLGLLAVFGAIGAFVLYKRYKQYKPIERSAGQAENQEGLSAYVSNFKAFFFPKSTERNPLLKSKPGIV 559

Plain text summary: download

Submission details:
Query regions file: yes
Orthology search: no
Gap restriction: yes
Surface accessibility check: yes
Intrinsical disorder check: no
Homology/domain filtering: yes
Show best suboptimal if no motifs found: no
Proteins total: 3
Job ID: ---sample---
Submitted: ---sample---
Completed: ---sample---
All real outputs will be deleted from the server after 7 days!